- PRRC2C Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88702
- 0.1 ml (also 25ul)
- Unconjugated
- PRRC2C
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: TTSQSSKQPP PSIRLPSAQT PNGTDYVASG KSIQTPQSHG TLTAELWDNK VAPPAVLNDI SKKLGPISPP QPPSVSAWNK PLTSFGSAP
- BAT2-iso, BAT2D1, BAT2L2, XTP2
- Human
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- proline rich coiled-coil 2C
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
TTSQSSKQPPPSIRLPSAQTPNGTDYVASGKSIQTPQSHGTLTAELWDNKVAPPAVLNDISKKLGPISPPQPPSVSAWNKPLTSFGSAP
Specifications/Features
Available conjugates: Unconjugated